DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S-2 and TfIIA-S

DIOPT Version :9

Sequence 1:NP_569877.1 Gene:TfIIA-S-2 / 31048 FlyBaseID:FBgn0040338 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_524467.1 Gene:TfIIA-S / 42822 FlyBaseID:FBgn0013347 Length:106 Species:Drosophila melanogaster


Alignment Length:101 Identity:56/101 - (55%)
Similarity:73/101 - (72%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNYQHYRATTLGRTLQDTLDEMMERGDITKKIANLVLLRYDKSISTALKDHGTSNMSFTAERLET 65
            |:||.||.||||.|||::|||:::.|.||..:|..|||::||||:.||.....:.::|.|.:|.|
  Fly     1 MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKAGKLNT 65

  Fly    66 FRCCDNVWTLILKDAEFREDQHSLKVDVVKIVACLG 101
            :|.|||||||:|.|.||||....:|||.||||||.|
  Fly    66 YRFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACDG 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-S-2NP_569877.1 TFIIA_gamma_N 2..50 CDD:199901 27/47 (57%)
TOA2 3..103 CDD:227452 55/99 (56%)
TFIIA_gamma_C 53..99 CDD:280847 25/45 (56%)
TfIIA-SNP_524467.1 TOA2 3..105 CDD:227452 55/99 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459010
Domainoid 1 1.000 52 1.000 Domainoid score I4273
eggNOG 1 0.900 - - E1_COG5123
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I3505
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55551
OrthoDB 1 1.010 - - D1589933at2759
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 1 1.000 - - otm3259
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - P PTHR10966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2529
1211.810

Return to query results.
Submit another query.