DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S-2 and GTF2A2

DIOPT Version :9

Sequence 1:NP_569877.1 Gene:TfIIA-S-2 / 31048 FlyBaseID:FBgn0040338 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001307858.1 Gene:GTF2A2 / 2958 HGNCID:4647 Length:109 Species:Homo sapiens


Alignment Length:106 Identity:52/106 - (49%)
Similarity:72/106 - (67%) Gaps:1/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNYQHYRATTLGRTLQDTLDEMMERGDITKKIANLVLLRYDKSISTALKDHGTSNMSFTAERLET 65
            |.||.||.||||.:||::|||:::...||.::|..|||::||:|:.||.....:.::|... |.|
Human     1 MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGS-LNT 64

  Fly    66 FRCCDNVWTLILKDAEFREDQHSLKVDVVKIVACLGTDNGN 106
            :|.||||||.:|.|.||||....:|||.||||||.|.:.|:
Human    65 YRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGS 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-S-2NP_569877.1 TFIIA_gamma_N 2..50 CDD:199901 24/47 (51%)
TOA2 3..103 CDD:227452 50/99 (51%)
TFIIA_gamma_C 53..99 CDD:280847 23/45 (51%)
GTF2A2NP_001307858.1 TOA2 3..103 CDD:227452 50/100 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55551
OrthoDB 1 1.010 - - D1589933at2759
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - O PTHR10966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2529
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.