DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S-2 and gtf-2A2

DIOPT Version :9

Sequence 1:NP_569877.1 Gene:TfIIA-S-2 / 31048 FlyBaseID:FBgn0040338 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_499644.1 Gene:gtf-2A2 / 176682 WormBaseID:WBGene00013736 Length:113 Species:Caenorhabditis elegans


Alignment Length:104 Identity:41/104 - (39%)
Similarity:61/104 - (58%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NYQHYRATTLGRTLQDTLDEMMERGDITKKIANLVLLRYDKSISTALKDHGTSNMSFTAERLETF 66
            |||.||.||||:.||.|||:.:....|...::..::..:||||:..|.....:.::|.|::|..:
 Worm     5 NYQLYRNTTLGQALQKTLDDFVGDQMIPDSLSKKIMDSFDKSINKILPHKAKNKVNFRADKLRAY 69

  Fly    67 RCCDNVWTLILKDAEFREDQHSLKVDVVKIVACLGTDNG 105
            |.||||||.|::..:.|:......||.:|||||.|...|
 Worm    70 RYCDNVWTFIVEQIDLRDAVEGGTVDRLKIVACDGQTKG 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-S-2NP_569877.1 TFIIA_gamma_N 2..50 CDD:199901 20/47 (43%)
TOA2 3..103 CDD:227452 39/99 (39%)
TFIIA_gamma_C 53..99 CDD:280847 17/45 (38%)
gtf-2A2NP_499644.1 TFIIA_gamma_N 5..53 CDD:199901 20/47 (43%)
TOA2 6..105 CDD:227452 38/98 (39%)
TFIIA_gamma_C 55..104 CDD:280847 19/48 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163360
Domainoid 1 1.000 50 1.000 Domainoid score I7812
eggNOG 1 0.900 - - E1_COG5123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I3505
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55551
OrthoDB 1 1.010 - - D1589933at2759
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 1 1.000 - - otm14768
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - O PTHR10966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2529
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.