DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S-2 and B0336.13

DIOPT Version :9

Sequence 1:NP_569877.1 Gene:TfIIA-S-2 / 31048 FlyBaseID:FBgn0040338 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001379557.1 Gene:B0336.13 / 175791 WormBaseID:WBGene00015150 Length:139 Species:Caenorhabditis elegans


Alignment Length:102 Identity:42/102 - (41%)
Similarity:63/102 - (61%) Gaps:2/102 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NYQHYRATTLGRTLQDTLDEMMERGDITKKIANLVLLRYDKSISTALKDHGTSNMSFTAERLETF 66
            :|..||.||||:.|..||::|...|.:||.:|:.||.::|||::..:.......|:|.|.:|.|:
 Worm     3 SYALYRGTTLGQALDKTLEDMESEGLLTKSLASKVLQQFDKSMNKQISRLPKEKMNFCATQLLTY 67

  Fly    67 RCCDNVWTLILKDAEFREDQHSL--KVDVVKIVACLG 101
            |.||||||.||.:...::.|.|.  .:|.:|:|||.|
 Worm    68 RYCDNVWTFILNNVTLKDPQRSFDEPIDKLKVVACDG 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-S-2NP_569877.1 TFIIA_gamma_N 2..50 CDD:199901 20/47 (43%)
TOA2 3..103 CDD:227452 42/101 (42%)
TFIIA_gamma_C 53..99 CDD:280847 19/47 (40%)
B0336.13NP_001379557.1 TOA2 4..108 CDD:227452 42/101 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163361
Domainoid 1 1.000 50 1.000 Domainoid score I7812
eggNOG 1 0.900 - - E1_COG5123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55551
OrthoDB 1 1.010 - - D1589933at2759
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 1 1.000 - - otm14247
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - O PTHR10966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2529
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.720

Return to query results.
Submit another query.