DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3690 and AT4G08878

DIOPT Version :9

Sequence 1:NP_001284764.1 Gene:CG3690 / 31047 FlyBaseID:FBgn0040350 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_680668.1 Gene:AT4G08878 / 826464 AraportID:AT4G08878 Length:280 Species:Arabidopsis thaliana


Alignment Length:242 Identity:53/242 - (21%)
Similarity:102/242 - (42%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FGMFN---ILLLVAAVPAAMGTVYETSTMSYILPSAECDLKLSLLDKGI---LNAITYAGMISSA 99
            :|.|.   .|.:::.:...:|.:|      |.:|.:...   ..|..||   ::.:.:||.....
plant    12 YGFFTDSYDLFVISLITKLLGRIY------YQVPGSSSP---GSLPDGISVAVSGVAFAGTFLGQ 67

  Fly   100 VLWGYLADIKGRRNLLIVGYAADTICVLGGALSQSR------IQLMVFKYLGGFCMSGPFAVLMT 158
            :.:|.|.|..||:.:..:.....|||.:..:||..:      :.|..|::..||.:.|.:.:..|
plant    68 IFFGCLGDKLGRKRVYGLTLLIMTICSIASSLSFGKDPKTVMVTLCFFRFWLGFGIGGDYPLSAT 132

  Fly   159 YLTELHGRKHRQRIMMMVGIMFSIATLTLPGLAMLI-------LPETWNIQIWTLSLTS-----W 211
            .:.|...::.|...:..|..|..:..|...|:::|:       .|....|.....|...     |
plant   133 IMFEYANKRTRGAFIASVFAMQGVGILAAGGVSLLVSYLFEIEFPSRAYILDGAASTVPQADYVW 197

  Fly   212 QFFVAVTALPSLLSFVLFFFFPESPKF--LMSKGRNREALDAFKFMY 256
            :..:.|.|||:||::......||:.::  |::|...:.|||..|.::
plant   198 RIILMVGALPALLTYYWRMKMPETARYTALVAKNAEQAALDMNKEIF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3690NP_001284764.1 SP 42..549 CDD:273317 53/241 (22%)
MFS 49..>195 CDD:119392 32/161 (20%)
MFS 419..>550 CDD:119392
AT4G08878NP_680668.1 MFS 13..>172 CDD:119392 35/167 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724235at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.