DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3690 and slc22a23

DIOPT Version :9

Sequence 1:NP_001284764.1 Gene:CG3690 / 31047 FlyBaseID:FBgn0040350 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001338637.1 Gene:slc22a23 / 555979 ZFINID:ZDB-GENE-030131-3564 Length:942 Species:Danio rerio


Alignment Length:301 Identity:76/301 - (25%)
Similarity:109/301 - (36%) Gaps:97/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GFGMF--NILL-------------LVAAVPAAMGTVY-----ETSTMSYILPSA----------- 73
            ||..|  |.||             |:...|.|:.||:     |.::.....||:           
Zfish    67 GFSQFSDNFLLTNPCPEPHNNSSQLLTVAPTAVSTVFTGVNTEAASQCNCTPSSYKLQNGLEQNI 131

  Fly    74 ------ECD-------LKLSLLDKGILNAITYAGMISSAVLWGYLADIKGRRNLLIVGYAADTIC 125
                  .||       .|.|||          .|.|...::.|.|||..||..:||:...  .:.
Zfish   132 VTKWNLVCDSAWKIHIAKFSLL----------VGSIFGYLVLGVLADWFGRHPVLILSVV--FLL 184

  Fly   126 VLGGALSQSRIQLMVF---KYLGGFCMSGPFAVLMTYLTELHGRKHRQRIMMMVGIMFSIATLTL 187
            |.|..::.| :.|.:|   ::..|||::|....|.....||.....|..|.|:...|.....|.:
Zfish   185 VFGMTVAFS-VNLPMFGTLRFFEGFCLAGITLSLYVLRIELCLPGWRFSITMVANFMMLAGQLLM 248

  Fly   188 PGLAMLILPETWNIQIWTLSLTSWQFFVAVTALPSLLSFVLFFFFPESPKFLM------------ 240
            ||||.|              ...||...||...|.||.....:.||||.::|:            
Zfish   249 PGLAAL--------------CRDWQILQAVIVCPLLLMLSYIWAFPESLRWLLATQQYSRSKWIM 299

  Fly   241 ---SKGRN---REALDAFKFMYHLN---SRKPKDSFPIKLL 272
               ||..|   :|  ||.:.|..||   .::||.:..:|::
Zfish   300 ERISKKNNINLQE--DAEELMTELNGALQKQPKKTCIVKMV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3690NP_001284764.1 SP 42..549 CDD:273317 74/299 (25%)
MFS 49..>195 CDD:119392 46/177 (26%)
MFS 419..>550 CDD:119392
slc22a23NP_001338637.1 Sugar_tr <131..547 CDD:331684 62/237 (26%)
Atrophin-1 630..>937 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.