DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3690 and CG4462

DIOPT Version :9

Sequence 1:NP_001284764.1 Gene:CG3690 / 31047 FlyBaseID:FBgn0040350 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_650849.1 Gene:CG4462 / 42376 FlyBaseID:FBgn0038752 Length:573 Species:Drosophila melanogaster


Alignment Length:317 Identity:59/317 - (18%)
Similarity:117/317 - (36%) Gaps:91/317 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSESGD-PKPH-------KTAEHQIGDPPQKEAAADFEAAIDAAG-FGMFN----ILLLVAAVPA 55
            |:..|: ..||       ...:.:|..||...|.:|..|  |..| ||::.    :::.:..:||
  Fly     6 PARGGESTAPHILPNEMENDVDKRIATPPPAPAGSDVIA--DVVGDFGIWQLRTILIIFLCKIPA 68

  Fly    56 A--------------------MGTVYETSTMS----------YIL-----PSAECDL--KLSLLD 83
            |                    ..|.|.||:.:          |:|     .|:||:.  .:|..|
  Fly    69 AWFMACIIFTGPELYPGSEFTCDTSYLTSSSNSSFSISDNQCYVLDESTGTSSECEQFNYVSSFD 133

  Fly    84 KGILN--------------------AITYAGMISSAVLWGYLADIKGRRNLLIVGYAADTICVLG 128
            ..|:.                    .:...|::.:.::.|.     ..|:...||..|..:|.:.
  Fly   134 SLIMQFNLVCLRDIFVAWTQYWHLFGVLVGGVMGTKMMLGI-----SPRSTYCVGAVAQILCGVV 193

  Fly   129 GALSQSRIQLMVFKYLGGFCMSGPFAVLMTYLTELHGRKHRQRIMMMVGIMFSIATLTLPGLAML 193
            ...::.......|:.|...|.:..|........::....||...:::....:||..:.||||:..
  Fly   194 TGYARDFSLHCAFRCLSAVCCAIMFTAGQAIFADITAGMHRIGAIILYDTFWSIGVILLPGLSSF 258

  Fly   194 ILPETWNIQIWTLSLTSWQFFVAVTALPSLLSFVLFFFFPESPKFLMSKGRNREALD 250
            .  .:|::           .:|.:| .|:::..:|.::.|:||::|:....:|.::|
  Fly   259 F--NSWSL-----------IYVGIT-FPTIMLILLLYWTPDSPRWLLRHAADRFSID 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3690NP_001284764.1 SP 42..549 CDD:273317 46/270 (17%)
MFS 49..>195 CDD:119392 34/202 (17%)
MFS 419..>550 CDD:119392
CG4462NP_650849.1 2A0119 <126..532 CDD:273328 33/195 (17%)
MFS 149..>284 CDD:119392 24/153 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458306
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.