DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3690 and CG6006

DIOPT Version :10

Sequence 1:NP_569876.3 Gene:CG3690 / 31047 FlyBaseID:FBgn0040350 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001097812.1 Gene:CG6006 / 41962 FlyBaseID:FBgn0063649 Length:603 Species:Drosophila melanogaster


Alignment Length:52 Identity:15/52 - (28%)
Similarity:24/52 - (46%) Gaps:12/52 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FAPRGIVPRSLPE------QPP----SRFTDWTVTTDSESDNSEFRKRAKAR 70
            |.|: |:..|.||      |||    :........|.:::.| |:|.:||.:
  Fly   278 FLPK-ILLMSRPEKGEVTKQPPLVNAASLVGSNYATAAKAAN-EYRNKAKGK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3690NP_569876.3 synapt_SV2 25..550 CDD:130366 15/52 (29%)
CG6006NP_001097812.1 MFS_SLC22 189..579 CDD:340875 15/52 (29%)

Return to query results.
Submit another query.