DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3690 and CG10486

DIOPT Version :9

Sequence 1:NP_001284764.1 Gene:CG3690 / 31047 FlyBaseID:FBgn0040350 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_647998.2 Gene:CG10486 / 38664 FlyBaseID:FBgn0035647 Length:706 Species:Drosophila melanogaster


Alignment Length:499 Identity:100/499 - (20%)
Similarity:186/499 - (37%) Gaps:125/499 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VPAAMGTVYETSTMSYILPSAE----CDLKLSLLDKGILNA--ITYAGMISSAVLWGYLADIKGR 111
            :|...|.|:|....::...:.|    ||     .||....|  |.:.|.|...:.:|:.||..||
  Fly   199 IPCKKGYVFEQEGRAFESATMEFGWLCD-----DDKYATYAQIIFFLGSILGGLAYGHFADHCGR 258

  Fly   112 RNLLIVGYAADTICVLGGALSQSRIQLMVFKYLGGFCMSGPFAVLMTYLTELHGRKHRQRIM-MM 175
            ...|:.......:..|..::|.......:.::|.|......|.::...:.|..|.|:|..:. :.
  Fly   259 VAALVSSCFLALVGSLATSMSTDFFTFAISRFLVGASYDTCFTMVYILVLEYVGPKYRTLVANLS 323

  Fly   176 VGIMFSIATLTLPGLAMLILPETWNIQIWTLSLTSWQFFVAVTALPSLLSFVLFFFFPESPKFLM 240
            :.:.:|..|:.:|.:|              ||..:|:.|.:.|:||.:|:...|...|||.::|:
  Fly   324 LALFYSPFTMVMPWIA--------------LSAGNWRRFSSFTSLPIVLAMFSFCLLPESARWLV 374

  Fly   241 SKGRNREALDAFKFMYHLNSRKPKDSFPIKLLANEVIVPVKKHAKDETIPTELKLPTECVEVQDP 305
            |.|...:||:..|.:..:|.::                 |.|...|       .....|.:.. .
  Fly   375 SVGEIDKALEILKNVIEVNKKQ-----------------VSKEILD-------LFEASCTQFY-K 414

  Fly   306 ENQDSKKSSLRSGFTQLRPLFTKPYLGLSLWVYLLNFCVLLGQNTMRLWLPQLFASINEYENLMS 370
            |..|.:..::.|.|.:.|               :..:.:|:    :.:|:     ||:   .:..
  Fly   415 EELDGRDFTVLSIFKRKR---------------MARYMILM----ILIWM-----SIS---LVYD 452

  Fly   371 GESQSTSIC---NILEYSVNRTQSQLEAVTRNDPTVECHVIITPSTYTNNLIV------AGAGFV 426
            |..::.|:.   ||..:.                |:.|     .:....|::|      ||..:.
  Fly   453 GHVRAASVLDSENIFLFF----------------TIAC-----ATELPGNILVILTLDRAGRRWC 496

  Fly   427 AY----------MLAGFLVNLVGVKLIMTSGLLIAAGC-SIGMYWSSSAASTVALAS--LFV-TM 477
            ::          :|.....|...:::...:|...:..| :||:.|::....||..|.  .|: ||
  Fly   497 SFFYTSLSGVFSLLGASFQNRANMRMSALAGRFFSNICYNIGLQWAAEILPTVVRAQGVAFIHTM 561

  Fly   478 GSISATSVISASVSLFPTSLRTMIVSLEMMFGRLGSLLGNIFFP 521
            |.: |..:....|.|...||.:.::.|..: |..|.||. :|.|
  Fly   562 GFV-AMLMSPPVVYLSKKSLSSTLIVLGAL-GIFGGLLA-LFLP 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3690NP_001284764.1 SP 42..549 CDD:273317 100/499 (20%)
MFS 49..>195 CDD:119392 32/148 (22%)
MFS 419..>550 CDD:119392 29/123 (24%)
CG10486NP_647998.2 2A0119 104..612 CDD:273328 100/499 (20%)
MFS 231..602 CDD:119392 90/460 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.