DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3690 and CarT

DIOPT Version :9

Sequence 1:NP_001284764.1 Gene:CG3690 / 31047 FlyBaseID:FBgn0040350 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_610052.1 Gene:CarT / 35334 FlyBaseID:FBgn0032879 Length:674 Species:Drosophila melanogaster


Alignment Length:479 Identity:103/479 - (21%)
Similarity:172/479 - (35%) Gaps:124/479 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VPAAMGTVYETSTMSYILPSAECDLKLSLLDKGI-----LNAITYAGMISSAVLWGYLADIKGRR 112
            :....|..|.||.   :..|...|..| :.|:.|     |.|:...|.: ...|:|.|.|..|||
  Fly   147 IKCPQGWEYNTSV---VWSSIVIDFDL-VCDQDIYPTIGLAALNTGGPV-GVYLFGLLNDRGGRR 206

  Fly   113 NLLIVGYAADTICVLGGALSQSRIQLMVFKYLGGFCMSG---------PFAVLMTYLTELHGRKH 168
                :.|......:|.|:|..| :....:.:.|...:.|         ||.:.:    ||.|..:
  Fly   207 ----LSYFVCLATLLAGSLMTS-LSKDFWTWAGSRVIVGLTIPAVYQIPFIISL----ELVGENY 262

  Fly   169 RQRIMMMVGIMFSIATLTLPGLAMLILPETWNIQIWTLSLTSWQFFVAVTALPSLLSFVLFFFFP 233
            |..:.:|....::...:.|.|:..|              ...|.....:|:||....|:..|..|
  Fly   263 RSFVTVMTCTFYTSGIMLLSGVTYL--------------ERDWVRLSYITSLPFYAYFLYMFVMP 313

  Fly   234 ESPKFLMSKGRNREALDAFKFMYHLNSRKPKDSFPIKLLANEVIVPVKKHAK--------DETIP 290
            |||::|:.:||..|||...:.|..:|.|:..::..:||.|......:||..|        |....
  Fly   314 ESPRWLLMRGRLEEALKILERMAKVNGREFPEAVHLKLEAQIRRDKLKKQKKKMANVGLADLCRT 378

  Fly   291 TELKLPTECVEVQDPENQDSKKSSLRSGFTQLRP-LFTKPYLG------------LSLWVYL--- 339
            ..::|.|..:.:....|:     ::..|.:...| |.|..|:.            |..|.::   
  Fly   379 PNMRLKTILITLSWFANE-----TVYLGLSYYGPALGTNQYVSFFLSAVVELPSYLCCWYFMDTW 438

  Fly   340 -----LNFCVLLG--QNTMRLWLPQLFASINE----YENLMSGESQSTSICNILEYSVNRTQSQL 393
                 |:..::||  ...:.:.||.  .:::|    |  |:|....|.|...|..::.....:|:
  Fly   439 GRRWPLSLSMILGGVACVITVMLPD--DAVDETLVLY--LVSKALLSASFLIIYPFAGELYPTQV 499

  Fly   394 EAVTRNDPTVECHVIITPSTYTNNLIVAGAGFVAYM----------LAGFLVNLVGVKLIMTSGL 448
            ..:.           |..|:|...|.:.|..|:.|:          :.|||..|.|:     :||
  Fly   500 RGIG-----------IGASSYIGGLGLIGIPFITYLGKDNLKLPLVIMGFLSMLGGM-----TGL 548

  Fly   449 ------------LIAAGCSIGMYW 460
                        .|..|...|..|
  Fly   549 RLPETLHHRLPQTIEEGEEFGKNW 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3690NP_001284764.1 SP 42..549 CDD:273317 103/479 (22%)
MFS 49..>195 CDD:119392 36/155 (23%)
MFS 419..>550 CDD:119392 14/64 (22%)
CarTNP_610052.1 2A0119 44..561 CDD:273328 99/466 (21%)
MFS 182..551 CDD:119392 90/417 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.