DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3690 and LOC101884074

DIOPT Version :9

Sequence 1:NP_001284764.1 Gene:CG3690 / 31047 FlyBaseID:FBgn0040350 Length:558 Species:Drosophila melanogaster
Sequence 2:XP_017208324.1 Gene:LOC101884074 / 101884074 -ID:- Length:363 Species:Danio rerio


Alignment Length:332 Identity:76/332 - (22%)
Similarity:134/332 - (40%) Gaps:48/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AAVPAAMGTVYETSTMSYILPSAECDLKLSLLDKGILNAITYAGMISSAVLWGYLADIKGRRNLL 115
            ||.||...:|.....:...:|...|      :..|   ::.|.||:..|..||.|:|..|||..|
Zfish    23 AAAPAMRISVCSAVNIRITIPFLFC------VSAG---SVVYLGMMVGAFFWGGLSDKVGRRQCL 78

  Fly   116 IVGYAADTICVLGGALSQSRIQLMVFKYLGGFCMSGPFAVLMTYLTELHGRKHRQRIMMMVGIMF 180
            :|..:.:.......:..|.....:..:.|.||.:.|...::.:|..|...|:.|...:..:.:.:
Zfish    79 LVCMSVNGFFAFLSSFVQGYSTFLFCRMLSGFGIGGAVPIVFSYFAEFLAREKRGEHLSWLCMFW 143

  Fly   181 SIATLTLPGLAMLILPETWNIQIWTLSL------TSWQFFVAVTALPSLLSFVLFFFFPESPKFL 239
            .:..:....:|..|:|...    |:.|:      .||:.||.|.|.|.:.:.|...|.||||:|.
Zfish   144 MVGGIYASAMAWAIIPHYG----WSFSMGSAYQFHSWRVFVVVCAFPCVSAVVALTFMPESPRFY 204

  Fly   240 MSKGRNREALDAFKFMYHLNSR---KPKDSFPIKLLANEVIVPVKKHAKDETIPTELKLPTECVE 301
            :..|::.||....|.::..|.|   :|:..|.:    |.:.:|              |...|.||
Zfish   205 LEMGKHDEAWMVLKQIHDTNMRARGEPEKVFTV----NRIKIP--------------KQLDELVE 251

  Fly   302 VQ-DPENQDSK-----KSSLRSGFTQLRPLFTKPYLGLSLWVYLLNFCVLLGQNTMRLWLPQLFA 360
            :| :..|...|     ||.|...:......:..|....::.:.::.|.:..|...:.:|.|.:..
Zfish   252 MQSESTNPVLKVLFRIKSELHGIWLTFLKCWDYPIKDNTVKLAIVWFSLSFGYYGLSVWFPDVIK 316

  Fly   361 SI--NEY 365
            .:  :||
Zfish   317 HLQADEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3690NP_001284764.1 SP 42..549 CDD:273317 76/332 (23%)
MFS 49..>195 CDD:119392 31/143 (22%)
MFS 419..>550 CDD:119392
LOC101884074XP_017208324.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724235at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.