DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and IRC24

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:197 Identity:62/197 - (31%)
Similarity:105/197 - (53%) Gaps:13/197 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVIVTGASSGIGAAIAQVLAREGATLALVG--RNVANLEATKKSLKGTQAEIVVADVTKDA--D 66
            ||:::||||.|||..:.:.:..|.....:.|  |..|.|::.::.....:....|.|:|..:  :
Yeast     3 KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITDRSRME 67

  Fly    67 AIVQQTLAKFGRIDVLVNNAGILGKGGLI-----DLDIEEFDAVLNTNLRGVILLTKAVLPHLLK 126
            |:|::...|.|::|.:|.|||:|.....|     :.||::::.:.:.|...::.|....|| |||
Yeast    68 ALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVALCLP-LLK 131

  Fly   127 TK---GAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHR 188
            :.   |.:|.|||.|.::|:.|..:||.|||||:.|...:|.|.....||...:.||.|.|.:.:
Yeast   132 SSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQK 196

  Fly   189 NI 190
            :|
Yeast   197 DI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 62/197 (31%)
NADB_Rossmann 3..248 CDD:304358 62/197 (31%)
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 61/196 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341271
Domainoid 1 1.000 86 1.000 Domainoid score I1866
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1506
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.