DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and NRE1

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_012301.3 Gene:NRE1 / 854853 SGDID:S000001474 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:72/196 - (36%)
Similarity:101/196 - (51%) Gaps:14/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK---GTQAEIVVADVTKDA-- 65
            ||::|||.|.|||.:|..||........:.|  ||..||..|.||   |.:...||.|:|:|:  
Yeast     3 KVILVTGVSRGIGKSIVDVLFSLDKDTVVYG--VARSEAPLKKLKEKYGDRFFYVVGDITEDSVL 65

  Fly    66 DAIVQQTLAKFGRIDVLVNNAGILGK-GGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKTKG 129
            ..:|...:...|:||.||.|||:|.. ..:.::|:..:..:.:.|...::.|....||.|.||.|
Yeast    66 KQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIALPELKKTNG 130

  Fly   130 AVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT----NIHRNI 190
            .||.|||.|....|:...:||.|||||:.|...:|.|  .:.|:..:|.||.|.|    ||..|:
Yeast   131 NVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKAIAVAPGIVDTDMQVNIRENV 193

  Fly   191 G 191
            |
Yeast   194 G 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 72/196 (37%)
NADB_Rossmann 3..248 CDD:304358 72/196 (37%)
NRE1NP_012301.3 SPR-like_SDR_c 4..246 CDD:187625 71/195 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341274
Domainoid 1 1.000 86 1.000 Domainoid score I1866
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1506
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.