DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and OAR1

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_012868.1 Gene:OAR1 / 853810 SGDID:S000001538 Length:278 Species:Saccharomyces cerevisiae


Alignment Length:287 Identity:71/287 - (24%)
Similarity:124/287 - (43%) Gaps:79/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGT-------------QAEIVV 58
            |.|||||:.|||.||.|.|.::|.:..::|       :||:|::.|             |.:..:
Yeast     6 VAIVTGATRGIGKAICQKLFQKGLSCIILG-------STKESIERTAIDRGQLQSGLSYQRQCAI 63

  Fly    59 A------------------DVTKDADAIVQQTLAKFG------------RIDVLVNNAGILGKGG 93
            |                  :..||...:.|:....|.            .:::|:|.||:..:..
Yeast    64 AIDFKKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINCAGLTQESL 128

  Fly    94 LIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKT------------KGAVVNVSSC--AGIRPFA 144
            .:.....:...::|.|....:.:|...:.:::|:            :..:||:||.  :|.....
Yeast   129 SVRTTASQIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVNISSILHSGKMKVP 193

  Fly   145 GALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVV-TNIHRNIGIVDEEYNGMLQRAI--- 205
            |...|..|||||.:||:::|.||.|:.:|..:::||.|. |::.:|:.:..:|   ||:|.|   
Yeast   194 GTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNLPVEAKE---MLERTIGAS 255

  Fly   206 -NSHPMGRVGDVTEVAEAVAFLASSKA 231
             .|.|       .|:||.|..|.|..|
Yeast   256 GTSAP-------AEIAEEVWSLYSRTA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 71/287 (25%)
NADB_Rossmann 3..248 CDD:304358 71/287 (25%)
OAR1NP_012868.1 SDR_c 7..275 CDD:212491 69/284 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.