DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and HSDL2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_115679.2 Gene:HSDL2 / 84263 HGNCID:18572 Length:418 Species:Homo sapiens


Alignment Length:311 Identity:80/311 - (25%)
Similarity:128/311 - (41%) Gaps:76/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRN--------------VANLEATKKSLKGTQ 53
            |:...|.:||||.|||.|||...|::||.:.:..:.              ...:||.     |.:
Human     8 LAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAV-----GGK 67

  Fly    54 AEIVVADV--TKDADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILL 116
            |...:.||  .:...|.|::.:.|||.||:|||||..:.....:|...:..|.::|.|.||..|.
Human    68 ALPCIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLA 132

  Fly   117 TKAVLPHLLKTKGA-VVNVSSCAGIRP--FAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVN 178
            :||.:|:|.|:|.| ::|:|....:.|  |....:|.::|..:..:...:|.|...: :.||::.
Human   133 SKACIPYLKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGE-IAVNALW 196

  Fly   179 PGFVVTNIH----------------RNIGIVDEEYNGMLQR------------------------ 203
            |   .|.||                |.:.|:.:....:.|:                        
Human   197 P---KTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFD 258

  Fly   204 --AIN-SHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHNLTPR 251
              ||. .||:.....:.|..|||     ||...:|||:......|..|.|:
Human   259 VYAIKPGHPLQPDFFLDEYPEAV-----SKKVESTGAVPEFKEEKLQLQPK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 77/302 (25%)
NADB_Rossmann 3..248 CDD:304358 78/306 (25%)
HSDL2NP_115679.2 HSDL2_SDR_c 8..248 CDD:187663 64/248 (26%)
SCP2 319..412 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.