DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and AT1G62610

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001185294.1 Gene:AT1G62610 / 842558 AraportID:AT1G62610 Length:282 Species:Arabidopsis thaliana


Alignment Length:256 Identity:93/256 - (36%)
Similarity:133/256 - (51%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK-----GTQAEIVVADVT 62
            |.:|||:|||||||||..|...|.:.|..:....|.|..|.:....:.     |.||..:..||:
plant    19 LKDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINSFGAIGVQAAALELDVS 83

  Fly    63 KDADAI---VQQTLAKFGRIDVLVNNAGILG--KGGLIDLDIEEFDAVLNTNLRGVILLTKAV-- 120
            .|||.|   |::....||.||||:|||||.|  |..| ||..||:|.|..|||.|..|::|.|  
plant    84 SDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSL-DLSKEEWDKVFRTNLTGSWLISKYVCL 147

  Fly   121 LPHLLKTKGAVVNVSSCAGIRP--FAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVV 183
            |....|..|:|:||||.:|:..  ..|.|:|..||..:|..|:::|:|:|...:||||:.||...
plant   148 LMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAVYKIRVNSIAPGIFR 212

  Fly   184 TNIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            :.|.:  |:..:|:...:...|....|.:..| ..:...|.:|....:.:.||..:.:|.|
plant   213 SEITQ--GLFQKEWLEKVTEKIVPLKMQQTVD-PGLTSLVRYLIHDSSQYVTGNTYIVDSG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 92/254 (36%)
NADB_Rossmann 3..248 CDD:304358 93/256 (36%)
AT1G62610NP_001185294.1 fabG 19..273 CDD:235546 93/256 (36%)
SDR_c 24..268 CDD:212491 88/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.