DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and AT1G24360

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_564216.1 Gene:AT1G24360 / 839053 AraportID:AT1G24360 Length:319 Species:Arabidopsis thaliana


Alignment Length:249 Identity:94/249 - (37%)
Similarity:137/249 - (55%) Gaps:13/249 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGA-TLALVGRNVANLEATKKSLK--GTQAEIVVADVTK- 63
            :.:.||::||||.|||.|||..|.:.|. .|....|:....|...|.::  |.||.....||:| 
plant    74 VESPVVVITGASRGIGKAIALALGKAGCKVLVNYARSAKEAEEVAKQIEEYGGQAITFGGDVSKA 138

  Fly    64 -DADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKT 127
             |.||:::..|.|:|.|||:||||||.....||.:...::|.|:..||.||.|.|:|.:..::|.
plant   139 TDVDAMMKTALDKWGTIDVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQAAVKIMMKK 203

  Fly   128 K-GAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIG 191
            | |.::|:||..|:....|..:|..:|..:..|:|..|.|.|.:.:.||.|.|||:.:::...:|
plant   204 KRGRIINISSVVGLIGNIGQANYAAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDMTAELG 268

  Fly   192 IVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLA-SSKASFTTGALFPIDGG 244
                  ..|.::.:.:.|:||.|...|||..|.||| |..||:.||..|.||||
plant   269 ------EDMEKKILGTIPLGRYGKAEEVAGLVEFLALSPAASYITGQAFTIDGG 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 92/247 (37%)
NADB_Rossmann 3..248 CDD:304358 94/249 (38%)
AT1G24360NP_564216.1 3oxo_ACP_reduc 79..318 CDD:273824 93/244 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.