DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and AT1G07450

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_172225.1 Gene:AT1G07450 / 837257 AraportID:AT1G07450 Length:260 Species:Arabidopsis thaliana


Alignment Length:256 Identity:78/256 - (30%)
Similarity:125/256 - (48%) Gaps:25/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKS-------LKGTQAEIVVA 59
            ||.....:|||.|.|||.||.:.|...||.:     ::.:::.|..:       .||.:....:.
plant     7 SLQGMTALVTGGSKGIGYAIVEELVGFGARV-----HICDIDETLLNECLSGWHAKGFEVSGSIC 66

  Fly    60 DVTKDADAI-VQQTLAK-FG-RIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
            ||:.....: :.||::. || ::::|:||.|.......::...|:|.:::.|||.....:::...
plant    67 DVSSRPQRVQLMQTVSSLFGAKLNILINNVGKYILKPTLESTAEDFSSLMATNLESAYYISQLAH 131

  Fly   122 PHLLKT--KGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT 184
            | |||.  .|.:|.:||..|:......: |||:|.||:|..:.:|.|.|...:|.|||.|....|
plant   132 P-LLKASGNGNIVFISSVTGVVSGTSTI-YGVTKGALNQLARDLACEWASDNIRANSVAPWVTAT 194

  Fly   185 NIHRNIGIVDEEY-NGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            ::.:.. :.||.: ..|..|.    |:||..:..|||..|.||....||:.||....||||
plant   195 SLVQKY-LEDEIFAEAMFSRT----PLGRACEPREVASLVTFLCLPAASYITGQTICIDGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 76/254 (30%)
NADB_Rossmann 3..248 CDD:304358 77/255 (30%)
AT1G07450NP_172225.1 PRK09242 5..256 CDD:181721 78/256 (30%)
NADB_Rossmann 5..254 CDD:304358 78/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.