DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and HSDL1

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_113651.4 Gene:HSDL1 / 83693 HGNCID:16475 Length:330 Species:Homo sapiens


Alignment Length:203 Identity:60/203 - (29%)
Similarity:102/203 - (50%) Gaps:32/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGT---QAEIVVADVTKDADAI-- 68
            :|:||:.|||.|.|:.||..|..:.|:.||...|:...|.:..|   :.:|:|||.:...:..  
Human    71 VVSGATDGIGKAYAEELASRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLP 135

  Fly    69 VQQTLAKFGRIDVLVNNAGI----------LGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPH 123
            :::.| |...:.:||||.|:          |.:..|.|        ::|.|:....|:...|||.
Human   136 IREAL-KDKDVGILVNNVGVFYPYPQYFTQLSEDKLWD--------IINVNIAAASLMVHVVLPG 191

  Fly   124 LL-KTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTN-- 185
            :: :.|||:|.:||.:..:|.....::..|||.||.|::.:..|.|.:|:.|.|:.|.:|.|:  
Human   192 MVERKKGAIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMT 256

  Fly   186 -----IHR 188
                 :||
Human   257 APSNFLHR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 60/203 (30%)
NADB_Rossmann 3..248 CDD:304358 60/203 (30%)
HSDL1NP_113651.4 Required for mitochondria translocation 2..82 6/10 (60%)
17beta-HSD1_like_SDR_c 67..309 CDD:187614 60/203 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.