Sequence 1: | NP_569875.2 | Gene: | CG3699 / 31046 | FlyBaseID: | FBgn0040349 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_113651.4 | Gene: | HSDL1 / 83693 | HGNCID: | 16475 | Length: | 330 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 60/203 - (29%) |
---|---|---|---|
Similarity: | 102/203 - (50%) | Gaps: | 32/203 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 IVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGT---QAEIVVADVTKDADAI-- 68
Fly 69 VQQTLAKFGRIDVLVNNAGI----------LGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPH 123
Fly 124 LL-KTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTN-- 185
Fly 186 -----IHR 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3699 | NP_569875.2 | fabG | 1..244 | CDD:235546 | 60/203 (30%) |
NADB_Rossmann | 3..248 | CDD:304358 | 60/203 (30%) | ||
HSDL1 | NP_113651.4 | Required for mitochondria translocation | 2..82 | 6/10 (60%) | |
17beta-HSD1_like_SDR_c | 67..309 | CDD:187614 | 60/203 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D913128at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |