DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and AT5G18210

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_197322.2 Gene:AT5G18210 / 831939 AraportID:AT5G18210 Length:277 Species:Arabidopsis thaliana


Alignment Length:270 Identity:80/270 - (29%)
Similarity:119/270 - (44%) Gaps:58/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEIVVADVTKDAD 66
            ||:.:|.||||:|.|||.|||..||..||.:.:           ..:.:.|:|:.|.|::...|.
plant     7 SLAGRVAIVTGSSRGIGRAIAIHLAELGAKIVI-----------NYTTRSTEADQVAAEINSSAG 60

  Fly    67 AIVQQTLAKF----------------------GRIDVLVNNAGILGKG--GLIDLDIEEFDAVLN 107
            .:.|.....|                      ..:.:|||:||||...  .:.:..|||||.:..
plant    61 TVPQPIAVVFLADISEPSQIKSLFDAAEKAFNSPVHILVNSAGILNPNYPTIANTPIEEFDRIFK 125

  Fly   108 TNLRGVILLTKAVLPHLLKTKGA---VVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAP 169
            .|.||..|..|.....|.:..|.   ::..|....:.|..||  |..||||::...||:|.|:..
plant   126 VNTRGSFLCCKEAAKRLKRGGGGRIILLTSSLTEALIPGQGA--YTASKAAVEAMVKILAKELKG 188

  Fly   170 QGVRVNSVNPGFVVTNIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFT 234
            .|:..|.|:||.|.|.:..: |..:|....:::|:    |.||:|:..::|..|.||||      
plant   189 LGITANCVSPGPVATEMFFD-GKSEETVMNIIERS----PFGRLGETKDIASVVGFLAS------ 242

  Fly   235 TGALFPIDGG 244
                   |||
plant   243 -------DGG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 78/268 (29%)
NADB_Rossmann 3..248 CDD:304358 79/269 (29%)
AT5G18210NP_197322.2 fabG 7..245 CDD:235500 78/268 (29%)
NADB_Rossmann 8..245 CDD:304358 77/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.