DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and AT3G55310

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_191091.2 Gene:AT3G55310 / 824697 AraportID:AT3G55310 Length:279 Species:Arabidopsis thaliana


Alignment Length:258 Identity:90/258 - (34%)
Similarity:140/258 - (54%) Gaps:23/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANL-----EATKKSLKGTQAEIVVADVT 62
            |.:|||:|||||||||..|...||:.|..:....|.|..|     |....|..|.||..:..||:
plant    17 LKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSSTGIQAAALELDVS 81

  Fly    63 KDADAIVQQTLAK----FGRIDVLVNNAGILGKGGL-IDLDIEEFDAVLNTNLRGVILLTK--AV 120
            .|| |.:|:.:.:    ||:||.|:|||||.|...| :||..:|:|.|.||||:|..|:.|  .|
plant    82 SDA-ATIQKAVREAWDIFGKIDALINNAGIRGNVKLSLDLSEDEWDNVFNTNLKGPWLVAKYVCV 145

  Fly   121 LPHLLKTKGAVVNVSSCAGIRPFA-GALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT 184
            |....|..|:|:|:||.||:|... |.|:|..||..:|..::::|:|:....:||||:.||...:
plant   146 LMRDAKRGGSVINISSVAGVRSIVPGGLAYSCSKGGVDTMSRMMAIELGVHKIRVNSIAPGLFKS 210

  Fly   185 NIHRNIGIVDEEY-NGMLQRAINSHPMGRVGDVTE--VAEAVAFLASSKASFTTGALFPIDGG 244
            .|.:  .::.:|: ..:.:|.:   |: :|....:  :...|.:|....:.:.:|..:.:|.|
plant   211 EITQ--ALMQKEWLKNVTERTV---PL-KVQQTIDPGLTSLVRYLIHDSSQYISGNTYIVDSG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 89/256 (35%)
NADB_Rossmann 3..248 CDD:304358 90/258 (35%)
AT3G55310NP_191091.2 SDR_c 22..265 CDD:212491 85/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.