DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and AT3G55290

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_567019.1 Gene:AT3G55290 / 824695 AraportID:AT3G55290 Length:280 Species:Arabidopsis thaliana


Alignment Length:259 Identity:93/259 - (35%)
Similarity:141/259 - (54%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANL-----EATKKSLKGTQAEIVVADVT 62
            |.:|||:|||||||||..|...||:.|..:....|.|..|     |....|..|.||..:..||:
plant    18 LKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSSTGIQAAALELDVS 82

  Fly    63 KDADAIVQQTLAK----FGRIDVLVNNAGILG--KGGLIDLDIEEFDAVLNTNLRGVILLTKAV- 120
            .|| |.:|:.:.:    ||:||.|:|||||.|  |..| ||..:|:|.|..|||:|..|::|.| 
plant    83 SDA-ATIQKAVREAWDIFGKIDALINNAGIRGNVKSSL-DLSEDEWDNVFKTNLKGPWLVSKHVC 145

  Fly   121 -LPHLLKTKGAVVNVSSCAGIR-PFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVV 183
             |....|..|:|:|:||.|||| ...|.|:|..||..:|..::::|||:....:||||:.||...
plant   146 MLMRDAKRGGSVINISSIAGIRGMLPGGLAYACSKGGVDTMSRMMALELGVHKIRVNSIAPGLFK 210

  Fly   184 TNIHRNIGIVDEEY-NGMLQRAINSHPMGRVGDVTE--VAEAVAFLASSKASFTTGALFPIDGG 244
            :.|.:  |::.:|: ..:.:|.:   |: :|....:  :...|.:|....:.:.:|..:.:|.|
plant   211 SEITQ--GLMQKEWLKNVTERTV---PL-KVQQTVDPGLTSLVRYLIHDSSQYISGNTYIVDSG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 92/257 (36%)
NADB_Rossmann 3..248 CDD:304358 93/259 (36%)
AT3G55290NP_567019.1 fabG 18..271 CDD:235546 93/259 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.