DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and SDR2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_190736.1 Gene:SDR2 / 824331 AraportID:AT3G51680 Length:303 Species:Arabidopsis thaliana


Alignment Length:263 Identity:89/263 - (33%)
Similarity:140/263 - (53%) Gaps:22/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVG-RNVANLEATKKSLKGTQAEIVVA----DVT 62
            |..||.|:||.:.|||.|...:.||.|||:.:.. .|||. .:..|||...:...:||    ||:
plant    32 LEGKVAIITGGAHGIGKATVMLFARHGATVVIADVDNVAG-SSLAKSLSSHKTSPMVAFISCDVS 95

  Fly    63 KDADA--IVQQTLAKFGRIDVLVNNAGILG----KGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
            .:||.  :|..|:|::||:|:|.||||:||    ...::|.|.:|||.|:..|:|||.|..|...
plant    96 VEADVENLVNVTVARYGRLDILFNNAGVLGDQKKHKSILDFDADEFDHVMRVNVRGVGLGMKHGA 160

  Fly   122 PHLLKT--KGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT 184
            ..::|.  ||.:::.:|.||:....|..:|..||.|:...||..|.|:...|:|||.::|..|.|
plant   161 RAMIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIVGLTKNAACELGKYGIRVNCISPFGVAT 225

  Fly   185 NIHRNI------GIVDEEYNGMLQRAINS--HPMGRVGDVTEVAEAVAFLASSKASFTTGALFPI 241
            ::..|.      |.|:::....::..:.|  :..|......::|||..:|||.::.:..|....:
plant   226 SMLVNAWRKTSGGDVEDDDVEEMEEFVRSLANLKGETLRANDIAEAALYLASDESKYVNGHNLVV 290

  Fly   242 DGG 244
            |||
plant   291 DGG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 87/261 (33%)
NADB_Rossmann 3..248 CDD:304358 89/263 (34%)
SDR2NP_190736.1 PLN02253 23..296 CDD:177895 89/263 (34%)
NADB_Rossmann 31..295 CDD:304358 89/263 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.