DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and HSD2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001154667.1 Gene:HSD2 / 823889 AraportID:AT3G47350 Length:321 Species:Arabidopsis thaliana


Alignment Length:272 Identity:81/272 - (29%)
Similarity:127/272 - (46%) Gaps:52/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLE---ATKKSLKGTQAEIVVADVT- 62
            :::.|||::||||||||..:|...|::||.||||.|....||   .|.:.|......|:..||: 
plant    43 NVTGKVVLITGASSGIGEHVAYEYAKKGAKLALVARRKDRLEIVAETSRQLGSGDVIIIPGDVSN 107

  Fly    63 -KDADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDL-DIEEFDAVLNTNLRGVILLTKAVLPHLL 125
             :|....:.:|:..||::|.|:||||:.......|. .|::.:::::.|..|...:|...:|||.
plant   108 VEDCKKFIDETIHHFGKLDHLINNAGVPQTVIFEDFTQIQDANSIMDINFWGSTYITYFAIPHLR 172

  Fly   126 KTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTN----- 185
            |:||.:|.:||...|.|...|..|..|||||.:|.:.:.:|::|. :::....|||:.|:     
plant   173 KSKGKIVVISSATAIIPLQAASVYSASKAALVKFFETLRVEISPD-IKITIALPGFISTDMTTPQ 236

  Fly   186 ---------------------IHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASS 229
                                 |.|.||   ||:.                |:..|...|....||
plant   237 FKEMYGSDFILSESVSRCAKAIFRGIG---EEFL----------------DLRSVRAIVVGFDSS 282

  Fly   230 KASFTTGALFPI 241
            |......:||.:
plant   283 KVLCDRNSLFSV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 81/272 (30%)
NADB_Rossmann 3..248 CDD:304358 81/271 (30%)
HSD2NP_001154667.1 NADB_Rossmann 44..262 CDD:304358 69/218 (32%)
adh_short 47..240 CDD:278532 67/193 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.