DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and AT3G29260

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_189571.1 Gene:AT3G29260 / 822582 AraportID:AT3G29260 Length:259 Species:Arabidopsis thaliana


Alignment Length:259 Identity:78/259 - (30%)
Similarity:121/259 - (46%) Gaps:31/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALV------GRNVANLEATKKSLKGTQAEIVVADV 61
            |..|:||:||.:|||||..|::....||.:.:|      |:|||      .|:...:|.....|:
plant     6 LDGKIVIITGGASGIGAEAARLFTDHGAKVVIVDLQEELGQNVA------VSIGLDKASFYRCDI 64

  Fly    62 TKDADA--IVQQTLAKFGRIDVLVNNAGIL-GKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPH 123
            |.:.:.  .|:.|:.|.|::|||.:|||:: ..|.::|||:|.||..:..|:||.....|.....
plant    65 TDETEVENAVKFTVEKHGKLDVLFSNAGVMEPHGSILDLDLEAFDRTMAVNVRGAAAFIKHAARS 129

  Fly   124 LLK--TKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNI 186
            ::.  |:|::|..:|........|..||..||.||....:.....:...|:|||.|.|..|.|.:
plant   130 MVASGTRGSIVCTTSVTAEIGGPGPHSYTASKHALLGLVRSACGGLGKYGIRVNGVAPYGVATGL 194

  Fly   187 HRNIGIVDEEYNGMLQRAINSH------PMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
                    ..||....:.:..:      ..|.|.....||:|..||||..:.:.:|....:|||
plant   195 --------TSYNEETVKMVEDYCSATAILKGVVLKARHVADAALFLASDDSVYISGQNLGVDGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 76/257 (30%)
NADB_Rossmann 3..248 CDD:304358 78/259 (30%)
AT3G29260NP_189571.1 PLN02253 1..254 CDD:177895 78/259 (30%)
NADB_Rossmann 5..252 CDD:304358 78/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.