DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and SDR4

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_189570.3 Gene:SDR4 / 822580 AraportID:AT3G29250 Length:298 Species:Arabidopsis thaliana


Alignment Length:257 Identity:80/257 - (31%)
Similarity:123/257 - (47%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALV------GRNVANLEATKKSLKGTQAEIVVADV 61
            |..|:.|:||.:|||||...::....||.:.:|      |:|:|      .|:...:|.....:|
plant    44 LDGKIAIITGGASGIGAEAVRLFTDHGAKVVIVDIQEELGQNLA------VSIGLDKASFYRCNV 102

  Fly    62 TKDADA--IVQQTLAKFGRIDVLVNNAGIL-GKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPH 123
            |.:.|.  .|:.|:.|.|::|||.:|||:| ..|.::|||:|.||..:..|:||.....|.....
plant   103 TDETDVENAVKFTVEKHGKLDVLFSNAGVLEAFGSVLDLDLEAFDRTMAVNVRGAAAFIKHAARS 167

  Fly   124 LLK--TKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNI 186
            ::.  |:|::|..:|.|......|..||..||.||....:.....:...|:|||.|.|..|.|.:
plant   168 MVASGTRGSIVCTTSIAAEIGGPGPHSYTASKHALLGLIRSACAGLGQYGIRVNGVAPYGVATGM 232

  Fly   187 HRNIGIVDEEYNGMLQRAINSHPMGRVGDVT----EVAEAVAFLASSKASFTTGALFPIDGG 244
               ....:||...||:.  ....:|.:..|.    .:|||..||||..:.:.:|....:|||
plant   233 ---TSAYNEEAVKMLEE--YGEALGNLKGVVLKARHIAEAALFLASDDSVYISGQNLVVDGG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 78/255 (31%)
NADB_Rossmann 3..248 CDD:304358 80/257 (31%)
SDR4NP_189570.3 PLN02253 42..293 CDD:177895 80/257 (31%)
NADB_Rossmann 44..291 CDD:304358 80/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.