DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and AT3G26770

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_566798.1 Gene:AT3G26770 / 822290 AraportID:AT3G26770 Length:306 Species:Arabidopsis thaliana


Alignment Length:262 Identity:85/262 - (32%)
Similarity:133/262 - (50%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEA-----TKKSLKGTQAEIVVADVT 62
            |..||.::||.:||:|.|.|....|.||.:.     :|:|:|     |.|.| |::||.|..|||
plant    41 LEGKVALITGGASGLGKATASEFLRHGARVV-----IADLDAETGTKTAKEL-GSEAEFVRCDVT 99

  Fly    63 KDAD--AIVQQTLAKFGRIDVLVNNAGILG---KGGLIDLDIEEFDAVLNTNLRGVILLTKAVLP 122
            .:||  ..|:.|:.::|::||:.|||||:|   ...:..||:.||:.|:..|:.||:...|....
plant   100 VEADIAGAVEMTVERYGKLDVMYNNAGIVGPMTPASISQLDMTEFERVMRINVFGVVSGIKHAAK 164

  Fly   123 HLLKTK-GAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT-- 184
            .::..: |.::..||.||:.......||.:||.......|..|.|:...|||:|.::||.|.|  
plant   165 FMIPARSGCILCTSSVAGVTGGLAPHSYTISKFTTPGIVKSAASELCEHGVRINCISPGTVATPL 229

  Fly   185 ---NIHRNIGIVDEEYNGMLQRAINSHPMGRVG----DVTEVAEAVAFLASSKASFTTGALFPID 242
               .:.:....|.||   .|:..:..  ||.:.    :..:||:|..:|||:...:.||....:|
plant   230 TLSYLQKVFPKVSEE---KLRETVKG--MGELKGAECEEADVAKAALYLASNDGKYVTGHNLVVD 289

  Fly   243 GG 244
            ||
plant   290 GG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 83/260 (32%)
NADB_Rossmann 3..248 CDD:304358 85/262 (32%)
AT3G26770NP_566798.1 PLN02253 38..294 CDD:177895 85/262 (32%)
NADB_Rossmann 40..293 CDD:304358 85/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.