DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and AT3G04000

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_566221.2 Gene:AT3G04000 / 819555 AraportID:AT3G04000 Length:272 Species:Arabidopsis thaliana


Alignment Length:270 Identity:72/270 - (26%)
Similarity:130/270 - (48%) Gaps:38/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL--------------KG 51
            :.|:.:|.||||:|.|||.|||..||..||.: :|..:.:.:||.|.:.              |.
plant    12 LCLAGRVAIVTGSSRGIGRAIAIHLAELGARV-VVNYSTSPVEAEKVATAITTNCSKDAEVAGKS 75

  Fly    52 TQAEIVVADVTK---------DADAIVQQTLAKFGRIDVLVNNAGIL--GKGGLIDLDIEEFDAV 105
            .:..:|.||:::         :|:.:.:..      :.:|||:|.|.  ....:.|:.:|.||.:
plant    76 PRVIVVKADISEPSQVKSLFDEAERVFESP------VHILVNSAAIADPNHSTISDMSVELFDRI 134

  Fly   106 LNTNLRGVILLTKAVLPHLLKTKGAVVNVSSCAGIRPF-AGALSYGVSKAALDQFTKIVALEMAP 169
            ::.|.||..:..:.....|.:..|..:.:.|.:.::.. ....||..||||::...||:|.|:..
plant   135 ISVNTRGAFICAREAANRLKRGGGGRIILLSTSLVQTLNTNYGSYTASKAAVEAMAKILAKELKG 199

  Fly   170 QGVRVNSVNPGFVVTNIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFT 234
            ..:.||.|:||.|.|.:... |:.:|    ::::..:.:..||:|:..::|..|.||||....:.
plant   200 TEITVNCVSPGPVATEMFYT-GLSNE----IVEKVKSQNLFGRIGETKDIAPVVGFLASDAGEWI 259

  Fly   235 TGALFPIDGG 244
            .|.:...:||
plant   260 NGQVIMANGG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 70/268 (26%)
NADB_Rossmann 3..248 CDD:304358 72/268 (27%)
AT3G04000NP_566221.2 SDR 14..269 CDD:330230 70/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.