DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and AT2G29320

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_180493.1 Gene:AT2G29320 / 817481 AraportID:AT2G29320 Length:269 Species:Arabidopsis thaliana


Alignment Length:252 Identity:84/252 - (33%)
Similarity:132/252 - (52%) Gaps:15/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLAL--VGRNVANLEATKKSLKGTQAEIVVADVTK- 63
            ||.....:||||:||||.||.:.||..||.:.:  :.:.:.|...::...||.|....|.|||. 
plant    12 SLQGMTALVTGAASGIGYAIVEELAGFGAKIHICDISKTLLNQSLSEWENKGFQVSGSVCDVTSH 76

  Fly    64 -DADAIVQQTLAKF-GRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLK 126
             :.:.::|...:.| |::::||||.|:|......:...::|...::|||.......:...| |||
plant    77 PEREKLMQTVSSIFDGKLNILVNNVGVLRGKPTTEYVADDFTFHISTNLEAAYHFCQLSHP-LLK 140

  Fly   127 TK--GAVVNVSSCAGIRPF--AGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIH 187
            ..  |::|.:||.||:...  .|:: ||::|.||:|..:.:|.|.|..|:|.|:|.|..|.|...
plant   141 ASGYGSIVFLSSVAGVVSLIDCGSI-YGLTKGALNQLARNLACEWAKDGIRANAVAPNVVKTAQS 204

  Fly   188 RNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            ::......:..|:|.|.    |:||||:..||:..|.||....||:.||....:|||
plant   205 QSFLEDVSKKEGLLSRT----PLGRVGEPNEVSSLVVFLCLPAASYITGQTICVDGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 82/250 (33%)
NADB_Rossmann 3..248 CDD:304358 83/251 (33%)
AT2G29320NP_180493.1 PRK09242 10..263 CDD:181721 84/252 (33%)
NADB_Rossmann 11..261 CDD:304358 84/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.