DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and AT2G29150

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_180479.1 Gene:AT2G29150 / 817464 AraportID:AT2G29150 Length:268 Species:Arabidopsis thaliana


Alignment Length:255 Identity:87/255 - (34%)
Similarity:136/255 - (53%) Gaps:23/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKK--SLKGTQAEIVVADVT-- 62
            ||.....:|||.|.|:|.|:.:.||..||.:....|:...|:...:  ..||.:....|.||:  
plant    15 SLEGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQERLREWQAKGFEVTTSVCDVSSR 79

  Fly    63 KDADAIVQQTLAKF-GRIDVLVNNAGILGKGGLI----DLDIEEFDAVLNTNLRGVILLTKAVLP 122
            :..:.:::...:.| |::::||||||.    |:|    :...|::..::.|||.....|::...|
plant    80 EQREKLMETVSSVFQGKLNILVNNAGT----GIIKPSTEYTAEDYSFLMATNLESAFHLSQIAHP 140

  Fly   123 HLLKT--KGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTN 185
             |||.  .|::|.:||.||: ...||..||.||.|::|..:.:|.|.|...:|||||.| :|:|.
plant   141 -LLKASGSGSIVFMSSVAGL-VHTGASIYGASKGAMNQLGRSLACEWASDNIRVNSVCP-WVITT 202

  Fly   186 IHRNIGIVDEEYNGMLQRAI-NSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            ...:....||:    |::|: :..||||||:..||:..||||....||:.||....:|||
plant   203 PLTSFIFSDEK----LRKAVEDKTPMGRVGEANEVSSLVAFLCFPAASYITGQTICVDGG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 85/253 (34%)
NADB_Rossmann 3..248 CDD:304358 86/254 (34%)
AT2G29150NP_180479.1 PRK09242 11..264 CDD:181721 87/255 (34%)
NADB_Rossmann 13..262 CDD:304358 87/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.