DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and HSD17B8

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_055049.1 Gene:HSD17B8 / 7923 HGNCID:3554 Length:261 Species:Homo sapiens


Alignment Length:258 Identity:85/258 - (32%)
Similarity:135/258 - (52%) Gaps:24/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAE---------IVV 58
            |.:.:.:||||.||||.|::..||.||||:|....:.|..:.|.:.|.|..::         ...
Human     9 LRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQ 73

  Fly    59 ADVT--KDADAIVQQTLAKFGR-IDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAV 120
            |||:  :.|..:::|..|.|.| ..|:|:.|||.....|:.:..:::|.|:..||:|..|:|:|.
Human    74 ADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAA 138

  Fly   121 LPHLLKT--KGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVV 183
            ...|:..  :|:::|:||..|.....|..:|..|||.:...|:..|.|:...|:|.|||.|||:.
Human   139 AQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIA 203

  Fly   184 TNIHRNI--GIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            |.:.:.:  .:||        :.....|||.:||..:||:.||||||..:.:.||....:.||
Human   204 TPMTQKVPQKVVD--------KITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 83/256 (32%)
NADB_Rossmann 3..248 CDD:304358 85/258 (33%)
HSD17B8NP_055049.1 BKR_SDR_c 13..260 CDD:187594 84/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.