DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and MGC147226

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_012816817.1 Gene:MGC147226 / 780086 XenbaseID:XB-GENE-5822220 Length:521 Species:Xenopus tropicalis


Alignment Length:253 Identity:85/253 - (33%)
Similarity:132/253 - (52%) Gaps:14/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEAT--KKSLKGTQAEIVVADVTK 63
            |.|..:|..|||...|||.|.|..|...||.:|:|...:...||.  :..:||.::..:.||::|
 Frog   272 MRLDGRVAYVTGGGQGIGRAFAHALGEAGAKVAVVDLMLEKAEAVAFELQVKGIKSVAIAADISK 336

  Fly    64 DADA--IVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLL- 125
            :.|.  ||...:..:||||:..|||||.......|..:||:|...:.||||:.:..:|....:| 
 Frog   337 EEDVKRIVDTIVTNWGRIDIACNNAGINMNSASEDTTLEEWDKTFSVNLRGLFMCCQAAGRVMLS 401

  Fly   126 KTKGAVVNVSSCAGI---RPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIH 187
            :..|.::|.:|.|.:   .| ...|:|..|||.:.:.|:.:..|...:|||||.::||.|.|.: 
 Frog   402 QGYGKIINTASMASLIVPHP-QKQLAYNTSKAGVVKLTQTLGTEWIDRGVRVNCISPGIVDTPL- 464

  Fly   188 RNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGK 245
                |..:....::||.:|..|.||:..||::...|.||||..:.:.||....|:||:
 Frog   465 ----IHSDALKPLVQRWLNDIPAGRLAQVTDLQAGVVFLASEASDYMTGHNLVIEGGQ 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 83/250 (33%)
NADB_Rossmann 3..248 CDD:304358 84/251 (33%)
MGC147226XP_012816817.1 AdoMet_MTases 78..241 CDD:388410
NADB_Rossmann 269..518 CDD:389744 84/251 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.