DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Hsdl1

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001365945.1 Gene:Hsdl1 / 72552 MGIID:1919802 Length:330 Species:Mus musculus


Alignment Length:196 Identity:56/196 - (28%)
Similarity:102/196 - (52%) Gaps:18/196 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGT---QAEIVVADVTKDAD--AI 68
            :::||:.|||.|.|:.||..|..:.|:.:....|:|..|.:..|   :..::|||.::..:  |.
Mouse    71 VISGATDGIGKAYAEELASHGLNVILISQEEEKLQAAAKHIADTYRVETLVLVADFSRGREIYAP 135

  Fly    69 VQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEE---FDAVLNTNLRGVILLTKAVLPHLL-KTKG 129
            :::.| :...|.:|||:.|...........:.|   :| ::|.|:....|:...|||.:: :.||
Mouse   136 IREAL-RDRDIGILVNDVGAFYPYPQYFSQVPEDTLWD-IVNVNIAAASLMVHIVLPGMVERKKG 198

  Fly   130 AVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTN-------IH 187
            |:|.|||.:..:|.....::..|||.||.|::.:..|.|.:|:.|.|:.|.:|.::       :|
Mouse   199 AIVTVSSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVTSSGAAPASFLH 263

  Fly   188 R 188
            |
Mouse   264 R 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 56/196 (29%)
NADB_Rossmann 3..248 CDD:304358 56/196 (29%)
Hsdl1NP_001365945.1 Required for mitochondria translocation. /evidence=ECO:0000250 2..82 5/10 (50%)
17beta-HSD1_like_SDR_c 67..309 CDD:187614 56/196 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.