DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Dhrs2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_082066.2 Gene:Dhrs2 / 71412 MGIID:1918662 Length:282 Species:Mus musculus


Alignment Length:251 Identity:82/251 - (32%)
Similarity:126/251 - (50%) Gaps:16/251 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK-------GTQAEIVVA 59
            ||:.||.::||::.|||.|||:.||::||.:.:..|...|::.....||       ||...:..|
Mouse    34 SLAGKVAVITGSTRGIGFAIARRLAQDGAHVVISSRKQENVDEAVTILKEEGLSVTGTMCHVGKA 98

  Fly    60 DVTKDADAIVQQTLAKFGRIDVLVNNAGILG-KGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPH 123
            :   |...:|...|...|.||.||..||:.. .|..:....:.:|.:|:.|::...||...|||:
Mouse    99 E---DRQHLVTTALKHSGGIDFLVCVAGVNPLVGSTLGASEQIWDKILDVNVKSPALLLSKVLPY 160

  Fly   124 LLKTK-GAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIH 187
            :...: |:||.|||.....|......|..||.||....|.:|:|:||:|:|||.:.||.:.|   
Mouse   161 MENRRGGSVVLVSSGVAYVPVPKLGVYNTSKTALLGLCKSLAVELAPKGIRVNCLVPGIIKT--- 222

  Fly   188 RNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDG 243
             :..:.::....||........:.|:|:..|.|..|:||.||.||:.||....:.|
Mouse   223 -DFSLREKTMPNMLPDMNKIFGVKRLGEPEECAGLVSFLCSSDASYITGENIMVAG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 82/251 (33%)
NADB_Rossmann 3..248 CDD:304358 81/250 (32%)
Dhrs2NP_082066.2 NADB_Rossmann 35..277 CDD:389744 80/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830565
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.