DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Dhrs2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001078405.4 Gene:Dhrs2 / 691464 RGDID:1583909 Length:289 Species:Rattus norvegicus


Alignment Length:248 Identity:84/248 - (33%)
Similarity:123/248 - (49%) Gaps:10/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK--GTQAEIVVADVTK- 63
            :|:.||.:|||::.|||.|||:.:||:||.:.:..|...|::.....||  |......|..|.| 
  Rat    41 TLAGKVAVVTGSTRGIGFAIARRMARDGAHVVISSRKQENVKEAVDILKEEGLSVTGTVCHVGKA 105

  Fly    64 -DADAIVQQTLAKFGRIDVLVNNAGILG-KGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHL-L 125
             |...:|...|...|.||.||..||:.. .|..:....:.:|.:|:.|::...||...||||: .
  Rat   106 EDRQHLVTTALKHSGGIDFLVCVAGVNPLVGSTLAASEQIWDKILDVNVKSPALLLSQVLPHMEN 170

  Fly   126 KTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNI 190
            :..|.||.|||.....|......|..||.||....|.:|:|:||:|:|||.:.||.:.|    :.
  Rat   171 RGGGCVVLVSSAVAYLPVPRLGVYNTSKTALLGLCKSLAVELAPKGIRVNCLAPGIIKT----DF 231

  Fly   191 GIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDG 243
            .:.:|....||........:.|:|:..|.|..|:||.||..|:.||....:.|
  Rat   232 SLREETMPNMLPELKKVFGVQRLGEPEECAGLVSFLCSSDGSYITGENIVVGG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 84/248 (34%)
NADB_Rossmann 3..248 CDD:304358 84/247 (34%)
Dhrs2XP_001078405.4 NADB_Rossmann 42..287 CDD:304358 84/247 (34%)
fabG 42..284 CDD:235975 83/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.