DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Decr1

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_080448.1 Gene:Decr1 / 67460 MGIID:1914710 Length:335 Species:Mus musculus


Alignment Length:264 Identity:71/264 - (26%)
Similarity:117/264 - (44%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK---GTQAEIVVADVTK 63
            :...||..:||..:|:|.|:...|:..||...:..||:..|:||.:.:.   |.:...:..|| :
Mouse    56 AFQGKVAFITGGGTGLGKAMTTFLSTLGAQCVIASRNIDVLKATAEEISSKTGNKVHAIRCDV-R 119

  Fly    64 DADAI---VQQTLAKFGRIDVLVNNAGILGKGGLID----LDIEEFDAVLNTNLRGVILLTKAVL 121
            |.|.:   |.:.:...|..||::|||.    |..|.    |....:..:.:..|.|...:|..:.
Mouse   120 DPDMVHNTVLELIKVAGHPDVVINNAA----GNFISPSERLTPNGWKTITDIVLNGTAYVTLEIG 180

  Fly   122 PHLLKT-KGA------VVNVSSCAG-IRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVN 178
            ..|:|. |||      .:...|.:| :.|.:.|      |:.::...|.:|.|....|:|.|.:.
Mouse   181 KQLIKAQKGAAFLAITTIYAESGSGFVMPSSSA------KSGVEAMNKSLAAEWGRYGMRFNIIQ 239

  Fly   179 PGFVVTNIHRNIGIVDE-EYNGMLQR-AINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPI 241
            ||.:.|.     |.... :..|..:: .|:..|.||:|.:.|:|....||.|..||:..||:...
Mouse   240 PGPIKTK-----GAFSRLDPTGRFEKEMIDRIPCGRLGTMEELANLATFLCSDYASWINGAVIRF 299

  Fly   242 DGGK 245
            |||:
Mouse   300 DGGE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 69/261 (26%)
NADB_Rossmann 3..248 CDD:304358 71/263 (27%)
Decr1NP_080448.1 TER_DECR_SDR_a 57..303 CDD:187627 70/261 (27%)
PRK07677 59..303 CDD:181077 70/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.