DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Hsd17b14

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_079606.3 Gene:Hsd17b14 / 66065 MGIID:1913315 Length:273 Species:Mus musculus


Alignment Length:244 Identity:89/244 - (36%)
Similarity:133/244 - (54%) Gaps:6/244 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEIVVADVTKDAD-- 66
            |.|||:|||.|.||||||.:.....||.:....::.|...|.::.|.||  ..:..|||::.|  
Mouse     8 SGKVVVVTGGSRGIGAAIVRAFVDSGAQVVFCDKDEAGGRALEQELSGT--VFIPGDVTQERDLQ 70

  Fly    67 AIVQQTLAKFGRIDVLVNNAGILGKGGL-IDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKTKGA 130
            .:|.:||::||.:|.:|||||......| .:...:.|..:|..||.|...|.|..||||.|::|.
Mouse    71 TLVSETLSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEVNLLGTYTLIKLALPHLRKSRGN 135

  Fly   131 VVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIGIVDE 195
            ::|:||..|....:.||:|..:|.|:...||.:||:.:..|||||.::||.:.|.:...:.....
Mouse   136 IINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRHGVRVNCISPGNIWTPLWEELAASTS 200

  Fly   196 EYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            :....:.....:.|:||:|...|||.|..||| |:|:|.||....:.||
Mouse   201 DPRATILEGTLAQPLGRMGQPAEVAAAAVFLA-SEATFCTGLELLVTGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 87/242 (36%)
NADB_Rossmann 3..248 CDD:304358 89/244 (36%)
Hsd17b14NP_079606.3 NADB_Rossmann 1..256 CDD:304358 89/244 (36%)
fabG 8..251 CDD:235546 89/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5109
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4415
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm42920
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.