DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Decr2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_741993.1 Gene:Decr2 / 64461 RGDID:71002 Length:292 Species:Rattus norvegicus


Alignment Length:261 Identity:80/261 - (30%)
Similarity:128/261 - (49%) Gaps:23/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANL-EATKKSLKGTQAEIVVAD----VT 62
            |.:||..:||..||||..||::..|.|....:|.|::..: ||.||.:..|....:...    |.
  Rat    26 LQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRVP 90

  Fly    63 KDADAIVQQTLAKFGRIDVLVNNAGILGKGGLI----DLDIEEFDAVLNTNLRGVILLTKAVLPH 123
            ....|.|.|.|.:||:||:|:|.|.    |..:    .|....|..|::.:..|...:::.:...
  Rat    91 PAVMAAVDQALKEFGKIDILINCAA----GNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEK 151

  Fly   124 LLKTKGAV-VNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVV-TNI 186
            ..:..|.| ||:::...:|.....|..|.:|||:|..|:.:|:|..||.:||||:.||.:. |..
  Rat   152 FFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEG 216

  Fly   187 HRNIG--IVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHNLT 249
            .|.:|  ....::..:      |.|:.|:|..||:|.:|.:|||..||:.:|.:..:|||.....
  Rat   217 LRRLGGPKASSKFKYL------SSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTL 275

  Fly   250 P 250
            |
  Rat   276 P 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 77/253 (30%)
NADB_Rossmann 3..248 CDD:304358 79/257 (31%)
Decr2NP_741993.1 TER_DECR_SDR_a 26..273 CDD:187627 79/256 (31%)
Substrate binding. /evidence=ECO:0000250 126..128 0/1 (0%)
Microbody targeting signal 290..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.