DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and PECR

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_060911.2 Gene:PECR / 55825 HGNCID:18281 Length:303 Species:Homo sapiens


Alignment Length:266 Identity:86/266 - (32%)
Similarity:128/266 - (48%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGT-----QAEIVVADVT 62
            |..:|.||||.::|||.||.:.|...|:.:.:..|.:..|::....|:..     ||.::.....
Human    16 LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCN 80

  Fly    63 ----KDADAIVQQTLAKFGRIDVLVNNAG---------ILGKGGLIDLDIEEFDAVLNTNLRGVI 114
                ::.:.:|:.||..||:|:.||||.|         |..||         :.|||.|||.|..
Human    81 IRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKG---------WHAVLETNLTGTF 136

  Fly   115 LLTKAVLPHLLKTK-GAVVN--VSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNS 176
            .:.|||....:|.. |::||  |.:.||   |..|:..|.::|.:...||.:|||.|..|:|:|.
Human   137 YMCKAVYSSWMKEHGGSIVNIIVPTKAG---FPLAVHSGAARAGVYNLTKSLALEWACSGIRINC 198

  Fly   177 VNPGFVVTNIH-RNIGIVDEE-YNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALF 239
            |.||.:.:... .|.|...:. :.|..|:.    |..|:|...||:..|.||.|..|||.||...
Human   199 VAPGVIYSQTAVENYGSWGQSFFEGSFQKI----PAKRIGVPEEVSSVVCFLLSPAASFITGQSV 259

  Fly   240 PIDGGK 245
            .:|||:
Human   260 DVDGGR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 84/263 (32%)
NADB_Rossmann 3..248 CDD:304358 86/266 (32%)
PECRNP_060911.2 TER_DECR_SDR_a 16..267 CDD:187627 86/266 (32%)
Microbody targeting signal 301..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.