DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and bdh2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001017809.1 Gene:bdh2 / 550507 ZFINID:ZDB-GENE-050417-343 Length:245 Species:Danio rerio


Alignment Length:261 Identity:85/261 - (32%)
Similarity:123/261 - (47%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQA-EIVVADVTK--D 64
            |..||::::.|:.|||.|.|...|:|||.:.....|...|    |.|.|... :..|.||||  .
Zfish     4 LDGKVIVLSAAAQGIGKASAIAFAKEGAQVTATDINGEKL----KELDGIPGIKTKVVDVTKKDQ 64

  Fly    65 ADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKTK- 128
            .||:.:.    |..:|||.|.||.:..|.::|.:..::|..:|.|:|.:.|:.||.||.:|..| 
Zfish    65 VDALAKD----FDHVDVLFNIAGFVHHGSILDCEESDWDFTMNVNVRSMYLMIKAFLPKMLARKS 125

  Fly   129 GAVVNVSSCA-GIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIGI 192
            |.::|::|.| .|:.......|..||||:...||.||.:...||:|.|.:.||.|.|        
Zfish   126 GNIINMASVASSIKGVVNRCVYSTSKAAVIGLTKSVAADFLEQGIRCNCICPGTVDT-------- 182

  Fly   193 VDEEYNGMLQRAINSHP--------------MGRVGDVTEVAEAVAFLASSKASFTTGALFPIDG 243
                  ..|:..|.:.|              .||:....|||....:|||.:::|.||....|||
Zfish   183 ------PSLRERIQARPDPEQAFKDFMARQRTGRLCTAEEVAHLCVYLASDESTFVTGTEVIIDG 241

  Fly   244 G 244
            |
Zfish   242 G 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 83/259 (32%)
NADB_Rossmann 3..248 CDD:304358 85/261 (33%)
bdh2NP_001017809.1 PRK06138 2..243 CDD:235712 85/261 (33%)
DHRS6_like_SDR_c 5..245 CDD:187626 84/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.