DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and pecr

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001017727.1 Gene:pecr / 550422 ZFINID:ZDB-GENE-050417-232 Length:299 Species:Danio rerio


Alignment Length:257 Identity:81/257 - (31%)
Similarity:128/257 - (49%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL----------KGTQAEIVV 58
            ::||.:|||..:|||.||...|.:.|.::.:..|.:..|::..:.|          |.|..|..:
Zfish    13 NHKVAVVTGGGTGIGKAITSELLQLGCSVVISSRKLERLKSAAEELTLKIPSSSPAKVTPIECNI 77

  Fly    59 --ADVTKDADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
              .|..|:   ::..||...||||.||||.|.........:..:.:.||::|||.|..|..:...
Zfish    78 RNEDEVKN---LMASTLKLHGRIDFLVNNGGGQFSSPANMMSAKGWKAVIDTNLNGTFLCCREAY 139

  Fly   122 PHLLKTKGAVVNVSSCAGI-RPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT- 184
            ...:|..|.|: |:..|.: :.|.|....|.::||:|..||.:|:|.|..|||:|||.||.::: 
Zfish   140 NAWMKDHGGVI-VNIIADMWKGFPGMAHTGAARAAVDNLTKSLAIEWAHSGVRINSVAPGTIISK 203

  Fly   185 NIHRNIGIVDEEYNGML-QRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGK 245
            ....|.    :||...| :.::...|..|:|...|::.||.||.|..|::.|||...:|.|:
Zfish   204 TAMENY----KEYGPTLFKMSVPFSPAKRLGVPEEISPAVCFLLSPAANYITGATLKVDAGQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 80/254 (31%)
NADB_Rossmann 3..248 CDD:304358 81/257 (32%)
pecrNP_001017727.1 fabG 28..263 CDD:235546 73/242 (30%)
TER_DECR_SDR_a 28..263 CDD:187627 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.