Sequence 1: | NP_569875.2 | Gene: | CG3699 / 31046 | FlyBaseID: | FBgn0040349 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081095.2 | Gene: | Dhrs1 / 52585 | MGIID: | 1196314 | Length: | 313 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 66/201 - (32%) |
---|---|---|---|
Similarity: | 101/201 - (50%) | Gaps: | 22/201 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK--GTQAEIVVADVTKDA 65
Fly 66 DA---IVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEF--------DAVLNTNLRGVILLT-- 117
Fly 118 --KAVLPHLLKTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPG 180
Fly 181 FVVTNI 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3699 | NP_569875.2 | fabG | 1..244 | CDD:235546 | 66/201 (33%) |
NADB_Rossmann | 3..248 | CDD:304358 | 66/201 (33%) | ||
Dhrs1 | NP_081095.2 | DHRS1-like_SDR_c | 5..271 | CDD:187664 | 66/201 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0725 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |