DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Dhrs1

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_081095.2 Gene:Dhrs1 / 52585 MGIID:1196314 Length:313 Species:Mus musculus


Alignment Length:201 Identity:66/201 - (32%)
Similarity:101/201 - (50%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK--GTQAEIVVADVTKDA 65
            :..:|.:|||||.|||..||..|.:.|||:.:.||::..|.||.:..:  |.:...||.|.::::
Mouse     5 MKGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRATAQEAQSLGGRCVPVVCDSSQES 69

  Fly    66 DA---IVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEF--------DAVLNTNLRGVILLT-- 117
            :.   ..|....:.||:||||||| ..|...:::...:.|        |.:.|..|||..|.:  
Mouse    70 EVKSLFEQVDREQKGRLDVLVNNA-YAGVQAILNTTNKSFWEVPASIWDDINNVGLRGHYLCSVY 133

  Fly   118 --KAVLPHLLKTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPG 180
              :.::|   ..||.:|.|||..|::.... :.|||.|||.|:.....|.|:...||...|:.||
Mouse   134 GARLMVP---AGKGLIVIVSSPGGLQHMFN-VPYGVGKAACDRLAADCAHELRRHGVSYVSLWPG 194

  Fly   181 FVVTNI 186
            .|.|.:
Mouse   195 LVQTEM 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 66/201 (33%)
NADB_Rossmann 3..248 CDD:304358 66/201 (33%)
Dhrs1NP_081095.2 DHRS1-like_SDR_c 5..271 CDD:187664 66/201 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.