DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and HSD17B14

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_057330.2 Gene:HSD17B14 / 51171 HGNCID:23238 Length:270 Species:Homo sapiens


Alignment Length:253 Identity:86/253 - (33%)
Similarity:135/253 - (53%) Gaps:24/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEIVVADVTKDAD-- 66
            :.|||:|||...||||.|.:.....||.:.:..::.:...|.::.|.|  |..::.|||::.|  
Human     8 AGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPG--AVFILCDVTQEDDVK 70

  Fly    67 AIVQQTLAKFGRIDVLVNNAG----------ILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
            .:|.:|:.:|||:|.:|||||          ...:|         |..:|..||.|...|||..|
Human    71 TLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQG---------FRQLLELNLLGTYTLTKLAL 126

  Fly   122 PHLLKTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNI 186
            |:|.|::|.|:|:||..|....|.|:.|..:|.|:...||.:||:.:|.|||||.::||.:.|.:
Human   127 PYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPL 191

  Fly   187 HRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            ...:..:..:....::..:.:.|:||:|...||..|..||| |:|:|.||....:.||
Human   192 WEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLA-SEANFCTGIELLVTGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 84/251 (33%)
NADB_Rossmann 3..248 CDD:304358 86/253 (34%)
HSD17B14NP_057330.2 RDH_SDR_c 1..256 CDD:187638 86/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5306
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4508
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.