DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and pecr

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031749362.1 Gene:pecr / 496922 XenbaseID:XB-GENE-1009809 Length:300 Species:Xenopus tropicalis


Alignment Length:264 Identity:91/264 - (34%)
Similarity:125/264 - (47%) Gaps:39/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEIVVADVT------- 62
            |||.||||..:|||.|||..|...|.::.:..|.:..|:.|.|.|....|....|.:|       
 Frog    14 NKVAIVTGGGTGIGKAIAAELLGLGCSVIIASRKLERLKETAKELTSRIAPASPALLTPLQCNIR 78

  Fly    63 --KDADAIVQQTLAKFGRIDVLVNNAG---------ILGKGGLIDLDIEEFDAVLNTNLRGVILL 116
              ::.:.:|:.||...||||.||||.|         |..||         ::||::|||.|....
 Frog    79 REEEVETLVKSTLGLHGRIDFLVNNGGGQFPSPSEAISAKG---------WNAVIDTNLTGTFYC 134

  Fly   117 TKAVLPHLLKTK-GAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPG 180
            .|||....:|.. ||:||:.:... :.|.|....|.::||:|..||.:|:|.|..|||:|||.||
 Frog   135 CKAVYNAWMKEHGGAIVNIVADMW-KGFPGMAHTGAARAAVDNLTKSLAIEWAHSGVRINSVAPG 198

  Fly   181 FVVTNIHRNIGIVDEEYNGM----LQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPI 241
            .:.:.      ...|.|..|    .|..|...|..|:|...||:..|.||.|..:||.:|....|
 Frog   199 TIFSQ------TAVENYKDMGPQLFQSYIPKIPAKRLGLPEEVSPTVCFLLSPASSFISGETIKI 257

  Fly   242 DGGK 245
            |.|:
 Frog   258 DAGQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 90/261 (34%)
NADB_Rossmann 3..248 CDD:304358 91/264 (34%)
pecrXP_031749362.1 TER_DECR_SDR_a 28..263 CDD:187627 81/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.