DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and hsdl1

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001008607.1 Gene:hsdl1 / 494064 ZFINID:ZDB-GENE-041212-31 Length:319 Species:Danio rerio


Alignment Length:189 Identity:52/189 - (27%)
Similarity:91/189 - (48%) Gaps:29/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK---GTQAEIVVADVTKD------ 64
            |:.|||..|..|.|:.|||.|..:.|:.::::::..|.:.:.   |.:|..:.||..:.      
Zfish    71 IICGASEAIAKAYAEELARHGICVILISKDLSSVSDTARLISNNYGVEAICIEADFNQGPSACKP 135

  Fly    65 -ADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLD---IEEFDAVL----NTNLRGVILLTKAVL 121
             .|||..:.      |..:||:.     .|.:::.   :|..::||    :.|:....|:|:..|
Zfish   136 IKDAISSKD------IGFIVNSF-----DGTLEISQNFLELSESVLWGTIDRNIAATTLVTRLAL 189

  Fly   122 PHLL-KTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNP 179
            |.:: :.:|||||:||.....|.....::..|.|.||.|::.:..|...|||.|.|:.|
Zfish   190 PAMMERGRGAVVNISSGHCFHPIPRKAAFSASTAFLDNFSRSLQYEYGDQGVFVQSLLP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 52/189 (28%)
NADB_Rossmann 3..248 CDD:304358 52/189 (28%)
hsdl1NP_001008607.1 Required for mitochondria translocation. /evidence=ECO:0000250 2..82 5/10 (50%)
17beta-HSD1_like_SDR_c 67..307 CDD:187614 52/189 (28%)
adh_short 68..248 CDD:278532 51/187 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.