DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and hsdl2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001008673.1 Gene:hsdl2 / 493329 XenbaseID:XB-GENE-5753362 Length:417 Species:Xenopus tropicalis


Alignment Length:276 Identity:73/276 - (26%)
Similarity:118/276 - (42%) Gaps:74/276 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGT----QAEI------- 56
            |:...:.:||||.|||.|||...||:||.:.:..:..   ||..| |.||    .:||       
 Frog     8 LAGCTLFITGASRGIGKAIALKAARDGANVVIAAKTA---EAHPK-LPGTIYTAASEIEAAGGKA 68

  Fly    57 --VVADVTKD--ADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLT 117
              .:.||..:  ..|.|::.:..||.||:|||||..:.....::..:::.|.::..|.||..|.:
 Frog    69 LPCIVDVRDENQISAAVEKAVDTFGGIDILVNNASAISLTNTLETPMKKVDLMMGINTRGTYLTS 133

  Fly   118 KAVLPHLLKTKGA-VVNVSSCAGIRP--FAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNP 179
            |..:|:|.|:|.| ::|:|....:.|  |....:|.::|..:    .:.||.|:           
 Frog   134 KICIPYLKKSKVAHILNLSPPLNLNPIWFKNHCAYTIAKYGM----SMCALGMS----------- 183

  Fly   180 GFVVTNIHRNIGIVDEEYNGML-------QRAINSHPMGRVG-----------DVTEVAEAVAFL 226
                           |||.|.:       :.||::..|..:|           |:  :|:|...:
 Frog   184 ---------------EEYKGEIAVNALWPKTAIHTAAMDMLGGSGVDKQCRTPDI--MADAAYAI 231

  Fly   227 ASSKASFTTGALFPID 242
            .|....||..  |.||
 Frog   232 LSKPKDFTGN--FVID 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 73/276 (26%)
NADB_Rossmann 3..248 CDD:304358 73/276 (26%)
hsdl2NP_001008673.1 HSDL2_SDR_c 8..248 CDD:187663 73/276 (26%)
SCP2 313..410 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.