DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and NME4

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_005000.1 Gene:NME4 / 4833 HGNCID:7852 Length:187 Species:Homo sapiens


Alignment Length:122 Identity:26/122 - (21%)
Similarity:39/122 - (31%) Gaps:45/122 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 RPFAGAL---------------SYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNI 190
            :||..||               .|.|.:|:........:.|.||..:|      |....:|.||:
Human    91 KPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIR------GDFSVHISRNV 149

  Fly   191 GIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHN 247
            ....:...| .||.|.                :.|.:|...|:.       |||:|:
Human   150 IHASDSVEG-AQREIQ----------------LWFQSSELVSWA-------DGGQHS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 23/117 (20%)
NADB_Rossmann 3..248 CDD:304358 26/122 (21%)
NME4NP_005000.1 NDK 38..172 CDD:197791 21/103 (20%)
NDPk_I 38..167 CDD:239876 19/98 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.876977 Normalized mean entropy S1395
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.