DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and zgc:101858

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001005597.1 Gene:zgc:101858 / 449555 ZFINID:ZDB-GENE-040927-13 Length:265 Species:Danio rerio


Alignment Length:255 Identity:120/255 - (47%)
Similarity:174/255 - (68%) Gaps:5/255 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK--GTQAEIVVADVTKD 64
            ||::||.::|||||||||..|.:.|:.||.|||.||:|.||....|..:  |....::||....|
Zfish    11 SLNDKVTLITGASSGIGAGTALLFAKLGARLALNGRDVENLTKVAKECEACGAAKPLLVAGDLTD 75

  Fly    65 ADAI---VQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLK 126
            .:.:   |::.:|.|||:|||||:||||..|.:...|:.::|.|::.|:|.:..||...:|||:|
Zfish    76 EETVRRTVEEVIAHFGRLDVLVNSAGILAMGSIETTDMAQYDKVMSVNVRSIYHLTHLCVPHLIK 140

  Fly   127 TKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIG 191
            |||::|||||..|.|.|.|.|:|.:||:|:||||:.||||:|.:.||||||.||.::|.:|:..|
Zfish   141 TKGSIVNVSSVNGQRSFPGVLAYCMSKSAIDQFTRCVALELASKQVRVNSVCPGVIITEVHKRAG 205

  Fly   192 IVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHNLTPR 251
            :.:|:|...:::...:|.:||.|:|.|||.|:|||||..|:|.||...|:|||:|.:.||
Zfish   206 LDEEQYAQFIEKCKVTHALGRPGEVDEVAHAIAFLASDAATFITGVNLPVDGGRHAMCPR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 115/246 (47%)
NADB_Rossmann 3..248 CDD:304358 117/249 (47%)
zgc:101858NP_001005597.1 fabG 11..260 CDD:235546 117/248 (47%)
SDR_c11 12..262 CDD:187622 117/249 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43975
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.