DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and MGC79752

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001005019.1 Gene:MGC79752 / 448527 XenbaseID:XB-GENE-5820599 Length:264 Species:Xenopus tropicalis


Alignment Length:256 Identity:123/256 - (48%)
Similarity:175/256 - (68%) Gaps:5/256 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATK---KSLKGTQAEIVVADVT 62
            ::|.:||.:||||||||||..|.:.||.||.|||.|||...|:.|.   :...|.:..:|..|:|
 Frog     9 INLKDKVCLVTGASSGIGAGTALLFARLGARLALNGRNEEKLQETAQGCEQFSGMKPLLVPGDLT 73

  Fly    63 KDADA--IVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLL 125
            .:...  ||:||:|.|||:|||||:.|||..|.:.:..:::||.|:|.|:|.:..||...:|||:
 Frog    74 DEESVRKIVEQTVAHFGRLDVLVNSGGILAMGTVENTSLQDFDRVMNVNVRSLFYLTHLAVPHLI 138

  Fly   126 KTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNI 190
            :|||.:|||||..|.|.|.|.|:|.:||:|:||.|:..|||:||:.||||:|.||.::|::||..
 Frog   139 QTKGNIVNVSSVNGQRSFPGVLAYCMSKSAVDQLTRCAALELAPKQVRVNAVCPGVIITDVHRRA 203

  Fly   191 GIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHNLTPR 251
            |:.:|:|:..:||..::|.:||.|.|.|||:.:|||||..|||.||...|:|||:|.:.||
 Frog   204 GLNEEQYSEFIQRTQHTHALGRPGTVDEVAKTIAFLASDAASFITGVTMPVDGGRHAMCPR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 118/247 (48%)
NADB_Rossmann 3..248 CDD:304358 121/249 (49%)
MGC79752NP_001005019.1 SDR_c11 11..261 CDD:187622 121/249 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43975
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.