DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and hsd17b14

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001003521.1 Gene:hsd17b14 / 445127 ZFINID:ZDB-GENE-040801-24 Length:271 Species:Danio rerio


Alignment Length:248 Identity:75/248 - (30%)
Similarity:119/248 - (47%) Gaps:9/248 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NKVVIVTGASSGIGAAIAQVLAREGATLALVGRNV-----ANLEATKKSLKGTQAEIVVADVTKD 64
            ||||||||.:.|||..|.:...:.|:.:.......     .:||:..........:.|..|:.::
Zfish     9 NKVVIVTGGTRGIGRGIVKTFVQNGSKVVFCAPQTEMSAGQSLESVLNKEGPGSCKFVSCDMREE 73

  Fly    65 AD--AIVQQTLAKFGRIDVLVNNAGILGKGGLID-LDIEEFDAVLNTNLRGVILLTKAVLPHLLK 126
            .|  .::..|:..||:||.||||.|........| ...|||..:||.||....|.:|..||:|.|
Zfish    74 EDIKQLINVTVESFGQIDCLVNNVGWHPPHKTTDETSGEEFKDLLNLNLISFFLASKYALPYLRK 138

  Fly   127 TKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIG 191
            |:|.::|:||.........|..|..:|.|:...||.:|::.:...||||.::|..::|.:...:.
Zfish   139 TQGNIINLSSLVASIGQKDAAPYVATKGAITAMTKAMAVDESRYQVRVNCISPSNIMTPLWEELA 203

  Fly   192 IVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            ...|:....::...::..:||:|...|...|..|||:. |:|.||....:.||
Zfish   204 ANTEDTAATIKGGEDAQLIGRMGTEAESGLAALFLAAD-ATFCTGIDLFLSGG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 73/246 (30%)
NADB_Rossmann 3..248 CDD:304358 75/248 (30%)
hsd17b14NP_001003521.1 RDH_SDR_c 1..263 CDD:187638 75/248 (30%)
adh_short 26..205 CDD:278532 48/178 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.